PMF1 Rabbit Polyclonal Antibody

SKU
TA332013
Rabbit Polyclonal Anti-PMF1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-PMF1 Antibody: synthetic peptide directed towards the middle region of human PMF1. Synthetic peptide located within the following region: TDCYKCFYQLQPAMTQQIYDKFIAQLQTSIREEISDIKEEGNLEAVLNAL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 19 kDa
Gene Name polyamine-modulated factor 1
Database Link
Background PMF1 is part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. It may act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
Synonyms Est1p-like protein B (EST1B); OTTHUMP00000016581; polyamine-modulated factor 1
Note Immunogen sequence homology: Goat: 100%; Human: 100%; Rat: 93%; Mouse: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Bovine: 79%; Rabbit: 79%
Reference Data
Protein Families Stem cell - Pluripotency
Write Your Own Review
You're reviewing:PMF1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.