MICAL2 Rabbit Polyclonal Antibody

SKU
TA331974
Rabbit Polyclonal Anti-MICAL2 Antibody
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-MICAL2 Antibody is: synthetic peptide directed towards the C-terminal region of Human MICAL2. Synthetic peptide located within the following region: GKFYCKPHFIHCKTNSKQRKRRAELKQQREEEATWQEQEAPRRDTPTESS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 86 kDa
Gene Name microtubule associated monooxygenase, calponin and LIM domain containing 2
Database Link
Background Monooxygenase that promotes depolymerization of F-actin by mediating oxidation of specific methionine residues on actin. It acts by modifying actin subunits through the addition of oxygen to form methionine-sulfoxide, leading to promote actin filament severing and prevent repolymerization.
Synonyms MICAL-2; MICAL2PV1; MICAL2PV2
Note Immunogen sequence homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 79%; Guinea pig: 79%
Reference Data
Write Your Own Review
You're reviewing:MICAL2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.