IST1 Rabbit Polyclonal Antibody

SKU TA331970

Rabbit Polyclonal Anti-IST1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-IST1 Antibody is: synthetic peptide directed towards the C-terminal region of Human IST1. Synthetic peptide located within the following region: TDLIDVGFTDDVKKGGPGRGGSGGFTAPVGGPDGTVPMPMPMPMPSANTP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: IST1, ESCRT-III associated factor
• Database Link:
  NP_055576
  P53990
• Background: IST1 is proposed to be involved in specific functions of the ESCRT machinery. It is required for efficient abscission during cytokinesis, but not for HIV-1 budding. The involvment in the MVB pathway is not established. IST1 is involved in recruiting VPS4A and/or VPS4B to the midbody of dividing cells.
• Synonyms: OLC1
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Pig: 92%; Horse: 92%; Guinea pig: 92%; Dog: 86%

Reference Data