TELO2 Rabbit Polyclonal Antibody

SKU TA331928

Rabbit Polyclonal Anti-TELO2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TELO2 Antibody is: synthetic peptide directed towards the C-terminal region of Human TELO2. Synthetic peptide located within the following region: LEDLMDELLEARSWLADVAEKDPDEDCRTLALRALLLLQRLKNRLLPPAS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 92 kDa
• Gene Name: telomere maintenance 2
• Database Link:
  NP_057195
  Q9Y4R8
• Background: This gene encodes a protein that functions as an S-phase checkpoint protein in the cell cycle. The protein may also play a role in DNA repair.
• Synonyms: CLK2; TEL2; YHFS
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Rabbit: 92%; Guinea pig: 92%; Dog: 85%; Bovine: 85%

Reference Data