ETV7 Rabbit Polyclonal Antibody

SKU TA331927

Rabbit Polyclonal Anti-ETV7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ETV7 Antibody: synthetic peptide directed towards the N terminal of human ETV7. Synthetic peptide located within the following region: SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: ETS variant 7
• Database Link:
  NP_057219
  Q9Y603
• Background: As a transcriptional repressor; ETV7 binds to the DNA sequence 5'-CCGGAAGT-3'. But Isoform A and isoform C do not seem to have a repressor activity.
• Synonyms: TEL-2; TEL2; TELB
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rabbit: 86%; Zebrafish: 79%; Rat: 77%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Dorso-ventral axis formation