TACO1 Rabbit Polyclonal Antibody

SKU TA331915

Rabbit Polyclonal Anti-TACO1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TACO1 Antibody is: synthetic peptide directed towards the C-terminal region of Human TACO1. Synthetic peptide located within the following region: NLERALEMAIEAGAEDVKETEDEEERNVFKFICDASSLHQVRKKLDSLGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 33 kDa
• Gene Name: translational activator of cytochrome c oxidase I
• Database Link:
  NP_057444
  Q9BSH4
• Background: This gene encodes a mitochondrial protein that function as a translational activator of mitochondrially-encoded cytochrome c oxidase 1. Mutations in this gene are associated with Leigh syndrome.
• Synonyms: CCDC44
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Bovine: 93%; Zebrafish: 86%; Guinea pig: 86%

Reference Data