TRIT1 Rabbit Polyclonal Antibody

SKU TA331891

Rabbit Polyclonal Anti-TRIT1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TRIT1 Antibody: synthetic peptide directed towards the middle region of human TRIT1. Synthetic peptide located within the following region: PHDKRKVARSLQVFEETGISHSEFLHRQHTEEGGGPLGGPLKFSNPCILW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: tRNA isopentenyltransferase 1
• Database Link:
  NP_060116
  Q9H3H1
• Background: TRIT1 is responsible for the modification of A37 to isopentenyl A37 of both cytosolic and mitochondrial tRNAs.
• Synonyms: GRO1; hGRO1; IPPT; IPT; IPTase; MOD5
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 92%; Guinea pig: 92%

Reference Data

• Protein Pathways: Metabolic pathways