MTMR10 Rabbit Polyclonal Antibody

SKU TA331884

Rabbit Polyclonal Anti-MTMR10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-MTMR10 Antibody is: synthetic peptide directed towards the C-terminal region of Human MTMR10. Synthetic peptide located within the following region: PRRNSLILKPKPDPAQQTDSQNSDTEQYFREWFSKPANLHGVILPRVSGT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 88 kDa
• Gene Name: myotubularin related protein 10
• Database Link:
  NP_060232
  Q9NXD2
• Background: MTMR10 is a probable pseudophosphatase. It contains a Glu residue instead of a conserved Cys residue in the dsPTPase catalytic loop which renders it catalytically inactive as a phosphatase.
• Synonyms: FLJ20313
• Note: Immunogen sequence homology: Human: 100%; Pig: 79%; Guinea pig: 79%; Horse: 77%; Mouse: 77%

Reference Data