INT11 (CPSF3L) Rabbit Polyclonal Antibody

SKU
TA331879
Rabbit Polyclonal Anti-CPSF3L Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CPSF3L Antibody is: synthetic peptide directed towards the C-terminal region of Human CPSF3L. Synthetic peptide located within the following region: TESTYATTIRDSKRCRERDFLKKVHETVERGGKGAHEPEGAHLLLHGADR
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name cleavage and polyadenylation specific factor 3-like
Database Link
Background The function of this protein remains unknown.
Synonyms CPSF73L; INT11; INTS11; RC-68; RC68
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 77%
Reference Data
Write Your Own Review
You're reviewing:INT11 (CPSF3L) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.