C12orf48 (PARPBP) Rabbit Polyclonal Antibody

SKU TA331876

Rabbit Polyclonal Anti-PARPBP Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PARPBP Antibody is: synthetic peptide directed towards the C-terminal region of Human PARPBP. Synthetic peptide located within the following region: YMENDLSEGVNPSVGRSTIGTSFGNVHLDRSKNEKVSRKSTSQTGNKSSK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: PARP1 binding protein
• Database Link:
  NP_060385
  Q9NWS1
• Background: PARPBP is required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. PARPBP antagonizes homologous recombination by interfering with the formation of the RAD51-DNA homologous recombination structure. It binds single-strand DNA and poly(A) homopolymers and positively regulate the poly(ADP-ribosyl)ation activity of PARP1; however such function may be indirect.
• Synonyms: AROM; C12orf48; PARI
• Note: Immunogen sequence homology: Human: 100%; Rat: 93%; Pig: 92%; Rabbit: 86%; Horse: 85%

Reference Data

• Protein Families: Druggable Genome