C12orf48 (PARPBP) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-PARPBP Antibody is: synthetic peptide directed towards the C-terminal region of Human PARPBP. Synthetic peptide located within the following region: YMENDLSEGVNPSVGRSTIGTSFGNVHLDRSKNEKVSRKSTSQTGNKSSK |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 32 kDa |
Gene Name | PARP1 binding protein |
Database Link | |
Background | PARPBP is required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. PARPBP antagonizes homologous recombination by interfering with the formation of the RAD51-DNA homologous recombination structure. It binds single-strand DNA and poly(A) homopolymers and positively regulate the poly(ADP-ribosyl)ation activity of PARP1; however such function may be indirect. |
Synonyms | AROM; C12orf48; PARI |
Note | Immunogen sequence homology: Human: 100%; Rat: 93%; Pig: 92%; Rabbit: 86%; Horse: 85% |
Reference Data | |
Protein Families | Druggable Genome |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.