RNF130 Rabbit Polyclonal Antibody

SKU TA331857

Rabbit Polyclonal Anti-RNF130 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RNF130 Antibody: synthetic peptide directed towards the N terminal of human RNF130. Synthetic peptide located within the following region: QEPGRGAPLTFRIDRGRYGLDSPKAEVRGQVLAPLPLHGVADHLGCDPQT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: ring finger protein 130
• Database Link:
  NP_060904
  Q86XS8
• Background: RNF130 contains a RING finger motif and is similar to g1, a Drosophila zinc-finger protein that is expressed in mesoderm and involved in embryonic development. The expression of the mouse counterpart was found to be upregulated in myeloblastic cells following IL3 deprivation, suggesting that this gene may regulate growth factor withdrawal-induced apoptosis of myeloid precursor cells.
• Synonyms: G1RZFP; GOLIATH; GP
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Transmembrane