PCMF (KCMF1) Rabbit Polyclonal Antibody

SKU TA331836

Rabbit Polyclonal Anti-KCMF1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-KCMF1 Antibody: synthetic peptide directed towards the N terminal of human KCMF1. Synthetic peptide located within the following region: SVEQPQSFTCPYCGKMGYTETSLQEHVTSEHAETSTEVICPICAALPGGD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: potassium channel modulatory factor 1
• Database Link:
  NP_064507
  Q9P0J7
• Background: KCMF1 belongs to the KCMF1 family. It contains 1 C2H2-type zinc finger and 1 ZZ-type zinc finger. It has intrinsic E3 ubiquitin ligase activity and promotes ubiquitination.
• Synonyms: DEBT91; FIGC; PCMF; ZZZ1
• Note: Immunogen sequence homology: Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Human: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 93%

Reference Data