BBX Rabbit Polyclonal Antibody

SKU TA331834

Rabbit Polyclonal Anti-BBX Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BBX Antibody: synthetic peptide directed towards the middle region of human BBX. Synthetic peptide located within the following region: KKTGNVSSEPTKTSKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 101 kDa
• Gene Name: bobby sox homolog (Drosophila)
• Database Link:
  NP_064620
  Q8WY36
• Background: BBX is a transcription factor that is necessary for cell cycle progression from G1 to S phase.
• Synonyms: ARTC1; HBP2; HSPC339; MDS001
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Guinea pig: 93%; Mouse: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Transcription Factors