REXO4 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-REXO4 Antibody: synthetic peptide directed towards the middle region of human REXO4. Synthetic peptide located within the following region: PADIEAAIGPEAAKIARKQLGQSEGSVSLSLVKEQAFGGLTRALALDCEM |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 47 kDa |
Gene Name | REX4 homolog, 3'-5' exonuclease |
Database Link | |
Background | The regulation of the quinone reductase (QR) gene as well as other genes involved in detoxification is known to be mediated by an electrophile response element (EpRE). QR gene regulation by the antiestrogen-occupied estrogen receptor (ER) is mediated by the EpRE-containing region of the human QR gene, and the ER is one of the complex of proteins that binds to the EpRE. REXO4 directly binds to the EpRE and interacts with the ER. The activation of QR gene activity by REXO4 is enhanced in the presence of ER beta. |
Synonyms | REX4; XPMC2; XPMC2H |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.