REXO4 Rabbit Polyclonal Antibody

SKU
TA331829
Rabbit Polyclonal Anti-REXO4 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-REXO4 Antibody: synthetic peptide directed towards the C terminal of human REXO4. Synthetic peptide located within the following region: QYGKCVYDKYVKPTEPVTDYRTAVSGIRPENLKQGEELEVVQKEVAEMLK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 47 kDa
Gene Name REX4 homolog, 3'-5' exonuclease
Database Link
Background The regulation of the quinone reductase (QR) gene as well as other genes involved in detoxification is known to be mediated by an electrophile response element (EpRE). QR gene regulation by the antiestrogen-occupied estrogen receptor (ER) is mediated by the EpRE-containing region of the human QR gene, and the ER is one of the complex of proteins that binds to the EpRE. REXO4 directly binds to the EpRE and interacts with the ER. The activation of QR gene activity by REXO4 is enhanced in the presence of ER beta.
Synonyms REX4; XPMC2; XPMC2H
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Horse: 92%; Zebrafish: 79%; Guinea pig: 79%; Bovine: 77%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:REXO4 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.