GRAMD1B Rabbit Polyclonal Antibody

SKU TA331820

Rabbit Polyclonal Anti-GRAMD1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GRAMD1B Antibody is: synthetic peptide directed towards the N-terminal region of Human GRAMD1B. Synthetic peptide located within the following region: SDHSSDKSPSTPEQGVQRSCSSQSGRSGGKNSKKSQSWYNVLSPTYKQRN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 81 kDa
• Gene Name: GRAM domain containing 1B
• Database Link:
  NP_065767
  Q3KR37
• Background: The function of this protein remains unknown.
• Synonyms: KIAA1201; MGC125622; MGC125623; MGC125625
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%

Reference Data

• Protein Families: Transmembrane