KIAA1543 (CAMSAP3) Rabbit Polyclonal Antibody

SKU TA331808

Rabbit Polyclonal Anti-CAMSAP3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CAMSAP3 Antibody is: synthetic peptide directed towards the C-terminal region of Human CAMSAP3. Synthetic peptide located within the following region: APSPSGLMSPSRLPGSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSN
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 137 kDa
• Gene Name: calmodulin regulated spectrin associated protein family member 3
• Database Link:
  NP_065953
  Q9P1Y5
• Background: Microtubule minus-end binding protein that acts as a regulator of microtubule dynamics. CAMSAP3 is specifically required for zonula adherens biogenesis and maintenance by anchoring microtubules at their minus-ends to zonula adherens, leading to recruit KIFC3 kinesin to junctional site.
• Synonyms: KIAA1543; NEZHA; PPP1R80
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Bovine: 86%; Guinea pig: 79%

Reference Data