OriGene Logo

Syntrophin (SNTB1) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA331806
Rabbit Polyclonal Anti-SNTB1 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
In Stock*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY412146 Transient overexpression lysate of syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1) (SNTB1) 100 ug
$665.00
TP324421 Recombinant protein of human syntrophin, beta 1 (dystrophin-associated protein A1, 59kDa, basic component 1) (SNTB1), 20 µg
20 ug
$737.00

View other "Syntrophin or NM_021021" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-SNTB1 Antibody: synthetic peptide directed towards the N terminal of human SNTB1. Synthetic peptide located within the following region: GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQEL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 58 kDa
Gene Name syntrophin beta 1
Database Link
Background Dystrophin is a large, rod-like cytoskeletal protein found at the inner surface of muscle fibers. Dystrophin is missing in Duchenne Muscular Dystrophy patients and is present in reduced amounts in Becker Muscular Dystrophy patients. The protein encoded by this gene is a peripheral membrane protein found associated with dystrophin and dystrophin-related proteins. This gene is a member of the syntrophin gene family, which contains at least two other structurally-related genes. provided by RefSeq, Jul 2008
Synonyms 59-DAP; A1B; BSYN2; DAPA1B; SNT2; SNT2B1; TIP-43
Note Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%
Reference Data
Protein Categories Intracellular Proteins
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.