RB associated KRAB repressor (RBAK) Rabbit Polyclonal Antibody

SKU TA331801

Rabbit Polyclonal Anti-RBAK Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RBAK Antibody: synthetic peptide directed towards the middle region of human RBAK. Synthetic peptide located within the following region: HYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHTEEKSHECSECGKFSQL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 83 kDa
• Gene Name: RB associated KRAB zinc finger
• Database Link:
  NP_066986
  Q9NYW8
• Background: RBAK is a nuclear protein which interacts with the tumor suppressor retinoblastoma 1. The two interacting proteins are thought to act as a transcriptional repressor for promoters which are activated by the E2F1 transcription factor. This protein contains a Kruppel-associated box (KRAB), which is a transcriptional repressor motif.
• Synonyms: ZNF769
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors