ZNFN1A4 (IKZF4) Rabbit Polyclonal Antibody

SKU TA331770

Rabbit Polyclonal Anti-ZNFN1A4 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNFN1A4 Antibody: synthetic peptide directed towards the N terminal of human ZNFN1A4. Synthetic peptide located within the following region: NSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSGPEP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 60 kDa
• Gene Name: IKAROS family zinc finger 4
• Database Link:
  NP_071910
  Q9H2S9
• Background: Members of the Ikaros (ZNFN1A1; MIM 603023) family of transcription factors, which includes Eos, are expressed in lymphocytes and are implicated in the control of lymphoid development. [supplied by OMIM]
• Synonyms: EOS; ZNFN1A4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%

Reference Data

• Protein Families: Transcription Factors