HROB Rabbit Polyclonal Antibody

SKU
TA331753
Rabbit Polyclonal Anti-C17orf53 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-C17orf53 Antibody is: synthetic peptide directed towards the middle region of Human C17orf53. Synthetic peptide located within the following region: QPFQSPSSWLSGKAHLPRPRTPNSSCSTPSRTSSGLFPRIPLQPQAPVSS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 57 kDa
Gene Name chromosome 17 open reading frame 53
Database Link
Background The function of this protein remains unknown.
Synonyms FLJ11594; MGC3130
Note Immunogen sequence homology: Human: 100%; Horse: 92%; Dog: 86%; Rabbit: 86%; Bovine: 79%
Reference Data
Write Your Own Review
You're reviewing:HROB Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.