PA1 (PAGR1) Rabbit Polyclonal Antibody

SKU TA331743

Rabbit Polyclonal Anti-PAGR1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-C16orf53 Antibody is: synthetic peptide directed towards the N-terminal region of Human C16orf53. Synthetic peptide located within the following region: GPSASAGKAEDEGEGGREETEREGSGGEEAQGEVPSAGGEEPAEEDSEDW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: PAXIP1 associated glutamate rich protein 1
• Database Link:
  NP_078792
  Q9BTK6
• Background: The function of this protein remains unknown.
• Synonyms: C16orf53; GAS; PA1
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 92%; Goat: 85%; Bovine: 85%; Pig: 83%; Horse: 83%

Reference Data