CARS2 Rabbit Polyclonal Antibody

SKU
TA331742
Rabbit Polyclonal Anti-CARS2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CARS2 Antibody is: synthetic peptide directed towards the N-terminal region of Human CARS2. Synthetic peptide located within the following region: GNAYSTAKGNVYFDLKSRGDKYGKLVGVVPGPVGEPADSDKRHASDFALW
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 62 kDa
Gene Name cysteinyl-tRNA synthetase 2, mitochondrial (putative)
Database Link
Background The function of this protein remains unknown.
Synonyms COXPD27; cysRS
Note Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 93%; Pig: 92%; Guinea pig: 92%; Bovine: 86%; Rabbit: 86%; Rat: 85%; Mouse: 85%
Reference Data
Protein Families Druggable Genome
Protein Pathways Aminoacyl-tRNA biosynthesis
Write Your Own Review
You're reviewing:CARS2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.