RSPH6A Rabbit Polyclonal Antibody

SKU TA331711

Rabbit Polyclonal Anti-RSPH6A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RSPH6A Antibody is: synthetic peptide directed towards the C-terminal region of Human RSPH6A. Synthetic peptide located within the following region: MANWVHHTQHILPQGRCTWVNPLQKTEEEEDLGEEEEKADEGPEEVEQEV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: radial spoke head 6 homolog A
• Database Link:
  NP_110412
  Q9H0K4
• Background: The protein encoded by this gene is similar to a sea urchin radial spoke head protein. Radial spoke protein complexes form part of the axoneme of eukaryotic flagella and are located between the axoneme's outer ring of doublet microtubules and central pair of microtubules. In Chlamydomonas, radial spoke proteins are thought to regulate the activity of dynein and the symmetry of flagellar bending patterns. This gene maps to a region of chromosome 19 that is linked to primary ciliary dyskinesia-2 (CILD2).
• Synonyms: RSHL1; RSP4; RSP6; RSPH4B
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Mouse: 86%

Reference Data