FAM117A Rabbit Polyclonal Antibody

SKU TA331707

Rabbit Polyclonal Anti-FAM117A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-FAM117A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM117A. Synthetic peptide located within the following region: SPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: family with sequence similarity 117 member A
• Database Link:
  NP_110429
  Q9C073
• Background: The function of this protein remains unknown.
• Synonyms: C; EBP-induced protein; EBP induced protein; family with sequence similarity 117; member A
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Zebrafish: 93%; Dog: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data