A2LD1 (GGACT) Rabbit Polyclonal Antibody

SKU TA331686

Rabbit Polyclonal Anti-GGACT Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-A2LD1 Antibody is: synthetic peptide directed towards the N-terminal region of Human A2LD1. Synthetic peptide located within the following region: GTLKRGQPNHRVLRDGAHGSAAFRARGRTLEPYPLVIAGEHNIPWLLHLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 16 kDa
• Gene Name: gamma-glutamylamine cyclotransferase
• Database Link:
  NP_149101
  Q9BVM4
• Background: The protein encoded by this gene aids in the proteolytic degradation of crosslinked fibrin by breaking down isodipeptide L-gamma-glutamyl-L-epsilon-lysine, a byproduct of fibrin degradation. The reaction catalyzed by the encoded gamma-glutamylaminecyclotransferase produces 5-oxo-L-proline and a free alkylamine. Two transcript variants encoding the same protein have been found for this gene.
• Synonyms: A2LD1
• Note: Immunogen sequence homology: Human: 100%; Horse: 90%; Pig: 86%; Bovine: 86%; Dog: 85%; Rabbit: 79%

Reference Data