SCAND3 (ZBED9) Rabbit Polyclonal Antibody

SKU TA331677

Rabbit Polyclonal Anti-ZNF452 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ZNF452 Antibody: synthetic peptide directed towards the n terminal of human ZNF452. Synthetic peptide located within the following region: EAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALRRNLSYTRELS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 152 kDa
• Gene Name: zinc finger BED-type containing 9
• Database Link:
  NP_443155
  Q6R2W3
• Background: ZNF452 (SCAND3) contains 1 integrase catalytic domain and 1 SCAN box domain. The function of ZNF452 remains unknown.
• Synonyms: Buster4; dJ1186N24.3; SCAND3; ZFP38-L; ZNF305P2; ZNF452
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Horse: 93%; Bovine: 92%; Mouse: 83%

Reference Data

• Protein Families: Transcription Factors