AMZ1 Rabbit Polyclonal Antibody

SKU TA331670

Rabbit Polyclonal Anti-AMZ1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-AMZ1 Antibody is: synthetic peptide directed towards the N-terminal region of Human AMZ1. Synthetic peptide located within the following region: LPSVAAASIRCSSRPSRDSDRLQLHTDGILSFLKNNKPGDALCVLGLTLS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: archaelysin family metallopeptidase 1
• Database Link:
  NP_597720
  Q400G9
• Background: AMZ1 is a Zinc metalloprotease. It exhibits aminopeptidase activity against neurogranin in vitro and does not hydrolyze angiotensin-2.
• Synonyms: KIAA1950
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 79%; Bovine: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data