CLEC4F Rabbit Polyclonal Antibody

SKU
TA331595
Rabbit Polyclonal Anti-CLEC4F Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-CLEC4F Antibody is: synthetic peptide directed towards the C-terminal region of Human CLEC4F. Synthetic peptide located within the following region: LRGHLERAGDEIHVLKRDLKMVTAQTQKANGRLDQTDTQIQVFKSEMENV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 65 kDa
Gene Name C-type lectin domain family 4 member F
Database Link
Background CLEC4F is a receptor with an affinity for galactose and fucose. It could be involved in endocytosis.
Synonyms CLECSF13; KCLR
Note Immunogen sequence homology: Human: 100%; Mouse: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:CLEC4F Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.