GXYLT1 Rabbit Polyclonal Antibody

SKU TA331593

Rabbit Polyclonal Anti-GXYLT1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GXYLT1 Antibody is: synthetic peptide directed towards the C-terminal region of Human GXYLT1. Synthetic peptide located within the following region: LFVFPCQWNYRPDHCIYGSNCQEAEEGGIFILHGNRGVYHDDKQPAFRAV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: glucoside xylosyltransferase 1
• Database Link:
  NP_775872
  Q4G148
• Background: GXYLT1 is a xylosyltransferase that adds the first xylose to O-glucose-modified residues in the epidermal growth factor repeats of proteins such as NOTCH1.
• Synonyms: GLT8D3
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 86%; Rabbit: 86%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane