BPIL3 (BPIFB6) Rabbit Polyclonal Antibody

SKU TA331588

Rabbit Polyclonal Anti-BPIFB6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-BPIFB6 Antibody is: synthetic peptide directed towards the N-terminal region of Human BPIFB6. Synthetic peptide located within the following region: EKMAAEAGKKQPGMKPIKGITNLKVKDVQLPVITLNFVPGVGIFQCVSTG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: BPI fold containing family B member 6
• Database Link:
  NP_777557
  Q8NFQ5
• Background: The function of this protein remains unknown.
• Synonyms: BPIL3; LPLUNC6
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rabbit: 93%; Rat: 86%; Horse: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein