GIYD2 (SLX1B) Rabbit Polyclonal Antibody

SKU TA331569

Rabbit Polyclonal Anti-SLX1B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLX1B Antibody is: synthetic peptide directed towards the C-terminal region of Human SLX1B. Synthetic peptide located within the following region: QEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTD
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: SLX1 homolog B, structure-specific endonuclease subunit
• Database Link:
  NP_835145
  Q9BQ83
• Background: This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more telomeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A4 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 4) gene.
• Synonyms: GIYD2
• Note: Immunogen sequence homology: Human: 100%; Horse: 90%; Yeast: 79%

Reference Data