STEAP3 Rabbit Polyclonal Antibody

SKU TA331539

Rabbit Polyclonal Anti-STEAP3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STEAP3 Antibody: synthetic peptide directed towards the C terminal of human STEAP3. Synthetic peptide located within the following region: VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: STEAP3 metalloreductase
• Database Link:
  NP_878919
  Q658P3
• Background: AS an endosomal ferrireductase, STEAP3 is required for efficient transferrin-dependent iron uptake in erythroid cells. It participates in erythroid iron homeostasis by reducing Fe(3+) to Fe(2+) and can also reduce of Cu(2+) to Cu(1+), suggesting that it participates in copper homeostasis. STEAP3 uses NAD(+) as acceptor (By similarity). It may play a role downstream of p53/TP53 to interface apoptosis and cell cycle progression. STEAP3 is indirectly involved in exosome secretion by facilitating the secretion of proteins such as TCT.
• Synonyms: AHMIO2; dudlin-2; dudulin-2; pHyde; STMP3; TSAP6
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Mouse: 86%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: p53 signaling pathway