PRSS55 Rabbit Polyclonal Antibody

SKU TA331524

Rabbit Polyclonal Anti-PRSS55 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-PRSS55 Antibody is: synthetic peptide directed towards the C-terminal region of Human PRSS55. Synthetic peptide located within the following region: SKMFPKLTKNMLCAGYKNESYDACKGDSGGPLVCTPEPGEKWYQVGIISW
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: protease, serine 55
• Database Link:
  NP_940866
  Q6UWB4
• Background: This gene encodes a member of a group of membrane-anchored chymotrypsin (S1)-like serine proteases. The enocoded protein is primarily expressed in the Leydig and Sertoli cells of the testis and may be involved in male fertility. Alternate splicing results in multiple transcript variants.
• Synonyms: CT153; T-SP1; TSP1; UNQ9391
• Note: Immunogen sequence homology: Human: 100%; Pig: 90%; Mouse: 85%; Dog: 79%; Horse: 79%; Bovine: 79%; Guinea pig: 79%; Rat: 77%

Reference Data

• Protein Families: Druggable Genome