TBC1D8B Rabbit Polyclonal Antibody

SKU TA331514

Rabbit Polyclonal Anti-TBC1D8B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-TBC1D8B Antibody is: synthetic peptide directed towards the N-terminal region of Human TBC1D8B. Synthetic peptide located within the following region: FDSNEDITNFVQGKIRGLIAEEGKHCFAKEDDPEKFREALLKFEKCFGLP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: TBC1 domain family member 8B
• Database Link:
  NP_942582
  Q0IIM8
• Background: TBC1D8B may act as a GTPase-activating protein for Rab family protein(s).
• Synonyms: GRAMD8B
• Note: Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86%; Rabbit: 86%

Reference Data