DDX46 Rabbit Polyclonal Antibody

SKU TA331474

Rabbit polyclonal Anti-DDX46 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DDX46 antibody: synthetic peptide directed towards the C terminal of human DDX46. Synthetic peptide located within the following region: GERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 113 kDa
• Gene Name: DEAD-box helicase 46
• Database Link:
  NP_055644
  Q7L014
• Background: DDX46 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX46 is a component of the 17S U2 snRNP complex; it plays an important role in pre-mRNA splicing.
• Synonyms: Prp5; PRPF5
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Pathways: Spliceosome