KCNH3 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-KCNH3 antibody: synthetic peptide directed towards the middle region of human KCNH3. Synthetic peptide located within the following region: LYPEFAPRFSRGLRGELSYNLGAGGGSAEVDTSSLSGDNTLMSTLEEKET |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 117 kDa |
Gene Name | potassium voltage-gated channel subfamily H member 3 |
Database Link | |
Background | The exact function of this protein remains unknown. |
Synonyms | BEC1; ELK2; Kv12.2 |
Note | Human: 100%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome, Ion Channels: Potassium, Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.