Foxk1 Rabbit Polyclonal Antibody
| Product Data | |
| Application | IHC, WB |
|---|---|
| Recommended Dilution | WB, IHC |
| Reactivity | Mouse |
| Antibody Host | Rabbit |
| Isotype | IgG |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-FOXK1 antibody: synthetic peptide directed towards the C terminal of mouse FOXK1. Synthetic peptide located within the following region: VVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEA |
| Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| Storage | Store at -20°C as received. |
| Stability | Stable for 12 months from date of receipt. |
| Shipping | Blue Ice |
| Predicted Protein Size | 68 kDa |
| Gene Name | forkhead box K1 |
| Database Link | |
| Background | Foxk1 is a transcriptional regulator that binds to the upstream enhancer region (CCAC box) of myoglobin gene. It has a role in myogenic differentiation and in remodeling processes of adult muscles that occur in response to physiological stimuli. |
| Synonyms | FLJ14977; FOXK1L; IMAGE:5164497; MNF |
| Note | Mouse: 100%; Rat: 93%; Pig: 86%; Guinea pig: 86% |
| Reference Data | |
Write Your Own Review
| Product Manuals |
| FAQs |
| SDS |
Related Products
Check items to add to the cart or
![GAPDH Mouse Monoclonal Antibody [Clone ID: OTI2D9]](https://cdn.origene.com/catalog/product/assets/images/antibody/100/ta802519-3-w.jpg?width=140&height=140&store=america&image-type=small_image)
![beta Actin (ACTB) Mouse Monoclonal Antibody [Clone ID: OTI1]](https://cdn.origene.com/catalog/product/assets/images/antibody/100/ta811000-3-w.jpg?width=140&height=140&store=america&image-type=small_image)
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.