Pou2f1 Rabbit Polyclonal Antibody

SKU TA331441

Rabbit polyclonal Anti-POU2F1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-POU2F1 antibody: synthetic peptide directed towards the C terminal of mouse POU2F1. Synthetic peptide located within the following region: VTSSTATTLTVNPVLPLTSAAVTNLSLTGKQQPAYRLVSTVPVRFLWRTA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: POU domain, class 2, transcription factor 1
• Database Link:
  NP_945150
  P25425
• Background: POU2F1 is a member of the POU family that represents the double-stranded DNA binding proteins specifically binding to the block C region.
• Synonyms: NF-A1; Oct-1; OCT1; OTF-1; OTF1; OTTHUMP00000032348
• Note: Mouse: 100%

Reference Data