Rhox11 Rabbit Polyclonal Antibody

SKU TA331440

Rabbit polyclonal Anti-RHOX11 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RHOX11 antibody: synthetic peptide directed towards the N terminal of mouse RHOX11. Synthetic peptide located within the following region: VMPNTQDTGREEPEETSKVAETSEQSLFRIPRKAYRFTPGQLWELQAVFV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: reproductive homeobox 11
• Database Link:
  NP_941000
• Background: Homeobox proteins are transcription factors notable for their ability to regulate embryogenesis. The reproductive homeobox proteins (Rhox) are expressed in a cell type-specific manner; several are hormonally regulated, and their expression pattern during postnatal testis development corresponds to their chromosomal position. Most of the Rhox proteins are expressed in Sertoli cells, the nurse cells in direct contact with developing male germ cells, suggesting that they regulate the expression of somatic-cell gene products critical for germ cell development.
• Synonyms: BC049711; Gm39; MGC58663
• Note: Mouse: 100%

Reference Data