Mafa Rabbit Polyclonal Antibody

SKU TA331438

Rabbit polyclonal Anti-Mafa Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Mafa antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KLEVGRLAKERDLYKEKYEKLAGRGGPGGAGGAGFPREPSPAQAGPGAAK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: v-maf musculoaponeurotic fibrosarcoma oncogene family, protein A (avian)
• Database Link:
  NP_919331
  Q8CF90
• Background: Mafa acts as a transcriptional factor. Mafa specifically binds the insulin enhancer element RIPE3b. Mafa cooperates synergistically with NEUROD1 and PDX1. Phosphorylation by GSK3 increases its transcriptional activity and is required for its oncogenic activity. Mafa regulates the insulin gene transcription. Mafa is involved either as an oncogene or as a tumor suppressor, depending on the cell context.
• Synonyms: hMafA; RIPE3b1
• Note: Rat: 100%; Mouse: 100%; Human: 86%

Reference Data