SFRS12IP1 (SREK1IP1) Rabbit Polyclonal Antibody

SKU
TA331422
Rabbit polyclonal Anti-SFRS12IP1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SFRS12IP1 antibody: synthetic peptide directed towards the N terminal of human SFRS12IP1. Synthetic peptide located within the following region: GYPGHLTFECRNFLRVDPKRDIVLDVSSTSSEDSDEENEELNKLQALQEK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 18 kDa
Gene Name SREK1 interacting protein 1
Database Link
Background SFRS12IP1 is a possible splicing regulator involved in the control of cellular survival.
Synonyms P18SRP; SFRS12IP1
Note Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Bovine: 93%; Zebrafish: 86%; Yeast: 77%
Reference Data
Write Your Own Review
You're reviewing:SFRS12IP1 (SREK1IP1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.