FAM80A (RIMKLA) Rabbit Polyclonal Antibody

SKU TA331406

Rabbit polyclonal Anti-FAM80A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM80A antibody: synthetic peptide directed towards the middle region of human FAM80A. Synthetic peptide located within the following region: EAEPLGYPVVVKSTRGHRGKAVFLARDKHHLSDICHLIRHDVPYLFQKYV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 38 kDa
• Gene Name: ribosomal modification protein rimK-like family member A
• Database Link:
  NP_775913
  Q8IXN7
• Background: The specific function of FAM80A is not yet known.
• Synonyms: FAM80A; NAAGS; NAAGS-II
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%; Zebrafish: 86%; Guinea pig: 86%

Reference Data