STK32C Rabbit Polyclonal Antibody

SKU TA331397

Rabbit polyclonal Anti-STK32A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-STK32A antibody is: synthetic peptide directed towards the N-terminal region of Human STK32A. Synthetic peptide located within the following region: PVFDENEDVNFDHFEILRAIGKGSFGKVCIVQKNDTKKMYAMKYMNKQKC
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: serine/threonine kinase 32C
• Database Link:
  NP_775846
  Q86UX6
• Background: STK32A belongs to the protein kinase superfamily, Ser/Thr protein kinase family. It contains 1 protein kinase domain. The function of the STK32A protein remains unknown.
• Synonyms: PKE; YANK3
• Note: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Horse: 85%; Rabbit: 85%; Dog: 77%; Bovine: 77%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase