ABHD7 (EPHX4) Rabbit Polyclonal Antibody

SKU TA331395

Rabbit polyclonal Anti-ABHD7 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ABHD7 antibody: synthetic peptide directed towards the N terminal of human ABHD7. Synthetic peptide located within the following region: HCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRYQLREFKSEY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: epoxide hydrolase 4
• Database Link:
  NP_775838
  Q8IUS5
• Background: The specific function of ABHD7 is not yet known.
• Synonyms: ABHD7; EH4; EPHXRP
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Protease, Transmembrane