CHID1 Rabbit Polyclonal Antibody

SKU TA331383

Rabbit Polyclonal Anti-CHID1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-CHID1 antibody is: synthetic peptide directed towards the N-terminal region of Human CHID1. Synthetic peptide located within the following region: CSPVHTTLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: chitinase domain containing 1
• Database Link:
  NP_001136149
  Q9BWS9
• Background: CHID1 is a saccharide- and LPS-binding protein with possible roles in pathogen sensing and endotoxin neutralization. Ligand-binding specificity relates to the length of the oligosaccharides, with preference for chitotetraose (in vitro).
• Synonyms: GL008; SI-CLP; SICLP
• Note: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Pig: 79%; Rabbit: 79%; Guinea pig: 79%

Reference Data