D2HGDH Rabbit Polyclonal Antibody

CAT#: TA331321

Rabbit Polyclonal Anti-D2HGDH Antibody

Product Images

WB Suggested Anti-D2HGDH Antibody; Titration: 1.0 ug/ml; Positive Control: PANC1 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-D2HGDH antibody is: synthetic peptide directed towards the C-terminal region of Human D2HGDH. Synthetic peptide located within the following region: QESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: D-2-hydroxyglutarate dehydrogenase
• Database Link:
  NP_689996
  Entrez Gene 728294 Human
  UniProt ID Q8N465
• Background: This gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase/transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features.
• Synonyms: D2HGD
• Note: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%; Horse: 86%; Dog: 79%; Pig: 77%