D2HGDH Rabbit Polyclonal Antibody

SKU TA331321

Rabbit Polyclonal Anti-D2HGDH Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-D2HGDH antibody is: synthetic peptide directed towards the C-terminal region of Human D2HGDH. Synthetic peptide located within the following region: QESPFYVLIETSGSNAGHDAEKLGHFLEHALGSGLVTDGTMATDQRKVKM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: D-2-hydroxyglutarate dehydrogenase
• Database Link:
  NP_689996
  Q8N465
• Background: This gene encodes D-2hydroxyglutarate dehydrogenase, a mitochondrial enzyme belonging to the FAD-binding oxidoreductase/transferase type 4 family. This enzyme, which is most active in liver and kidney but also active in heart and brain, converts D-2-hydroxyglutarate to 2-ketoglutarate. Mutations in this gene are present in D-2-hydroxyglutaric aciduria, a rare recessive neurometabolic disorder causing developmental delay, epilepsy, hypotonia, and dysmorphic features.
• Synonyms: D2HGD
• Note: Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 92%; Horse: 86%; Dog: 79%; Pig: 77%

Reference Data