ARH3 (ADPRHL2) Rabbit Polyclonal Antibody

CAT#: TA331306

Rabbit Polyclonal Anti-ADPRHL2 Antibody

Product Images

WB Suggested Anti-ADPRHL2 Antibody; Titration: 1.0 ug/ml; Positive Control: HepG2 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ADPRHL2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADPRHL2. Synthetic peptide located within the following region: SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: ADP-ribosylhydrolase like 2
• Database Link:
  NP_060295
  Entrez Gene 54936 Human
  UniProt ID Q9NX46
• Background: This gene encodes a member of the ADP
• Synonyms: ARH3
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%