SLC13A4 Rabbit Polyclonal Antibody

SKU TA331294

Rabbit Polyclonal Anti-SLC13A4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC13A4 antibody is: synthetic peptide directed towards the middle region of Human SLC13A4. Synthetic peptide located within the following region: NPIKTANQHQGKKQHPSQEKPQVLTPSPRKQKLNRKYRSHHDQMICKCLS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 69 kDa
• Gene Name: solute carrier family 13 member 4
• Database Link:
  NP_036582
  Q9UKG4
• Background: SLC13A4 is a sodium/sulfate cotransporter that mediates sulfate reabsorption in the high endothelial venules (HEV).
• Synonyms: NAS2; SUT-1; SUT1
• Note: Human: 100%; Dog: 91%; Bovine: 90%; Horse: 85%; Rat: 79%; Mouse: 79%

Reference Data

• Protein Families: Transmembrane